SYNJ2BP/ARIP2 Antibody
| Name | SYNJ2BP/ARIP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88985 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SYNJ2BP/ARIP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SYNJ2BP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in mouse cerebral cortex tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9124_SYNJ2BP-ARIP2-Antibody-Western-Blot-NBP1-88985-img0012.jpg)
Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in mouse cerebral cortex tissue.
![Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9125_SYNJ2BP-ARIP2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88985-img0013.jpg)
Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9126_SYNJ2BP-ARIP2-Antibody-Immunohistochemistry-Paraffin-NBP1-88985-img0002.jpg)
Immunohistochemistry-Paraffin: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
![Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9127_SYNJ2BP-ARIP2-Antibody-Western-Blot-NBP1-88985-img0009.jpg)
Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
![Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9128_SYNJ2BP-ARIP2-Antibody-Western-Blot-NBP1-88985-img0011.jpg)
Western Blot: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Analysis in human cell line RT-4.
![Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse hippocampus shows strong immunoreactivity in synapses.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9129_SYNJ2BP-ARIP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88985-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse hippocampus shows strong immunoreactivity in synapses.
![Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse globus pallidus shows weak labelling of synapses and neuronal processes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9130_SYNJ2BP-ARIP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88985-img0006.jpg)
Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse globus pallidus shows weak labelling of synapses and neuronal processes.
![Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse parietal association cortex shows strong synaptic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/9131_SYNJ2BP-ARIP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88985-img0007.jpg)
Immunocytochemistry/Immunofluorescence: SYNJ2BP/ARIP2 Antibody [NBP1-88985] - Staining of mouse parietal association cortex shows strong synaptic positivity.