DEFA6 Antibody
| Name | DEFA6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84281 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DEFA6 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DEFA6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22292_DEFA6%2520Antibody-Western%2520Blot-NBP1-84281-img0007.jpg)
![Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human duodenum shows strong cytoplasmic positivity in a subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22293_DEFA6-Antibody-Immunohistochemistry-Paraffin-NBP1-84281-img0006.jpg)