RBM10 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84951
• Prices: $129.00, $419.00
• Sizes: 25 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRR
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: RBM10 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: RBM10
• Conjugate: Unconjugated

Product images

Western Blot: RBM10 Antibody [NBP1-84951] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: RBM10 Antibody [NBP1-84951] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles.

Immunohistochemistry-Paraffin: RBM10 Antibody [NBP1-84951] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Western Blot: RBM10 Antibody [NBP1-84951] - Analysis in human cell line A-549.