NMD3 Antibody
| Name | NMD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84524 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VPICKDNVVCLSPKLAQSLGNMNQICVCIRVTSAIHLIDPNTLQVADIDGSTFWSHPFNSLCHPKQLEEFIVMECSIVQDIKRAA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NMD3 Protein |
| Description | Rabbit Polyclonal |
| Gene | NMD3 |
| Supplier Page | Shop |
Product images
![Western Blot: NMD3 Antibody [NBP1-84524] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7880_NMD3-Antibody-Western-Blot-NBP1-84524-img0006.jpg)
Western Blot: NMD3 Antibody [NBP1-84524] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: NMD3 Antibody [NBP1-84524] - Staining of human cell line A-431 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/7881_NMD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84524-img0004.jpg)
Immunocytochemistry/Immunofluorescence: NMD3 Antibody [NBP1-84524] - Staining of human cell line A-431 shows positivity in nucleus.
![Western Blot: NMD3 Antibody [NBP1-84524] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23651_NMD3%2520Antibody-Western%2520Blot-NBP1-84524-img0008.jpg)
Western Blot: NMD3 Antibody [NBP1-84524] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunohistochemistry-Paraffin: NMD3 Antibody [NBP1-84524] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/23652_NMD3-Antibody-Immunohistochemistry-Paraffin-NBP1-84524-img0007.jpg)
Immunohistochemistry-Paraffin: NMD3 Antibody [NBP1-84524] - Staining of human small intestine shows strong luminal membranous positivity in glandular cells.