CPSF6 Antibody
| Name | CPSF6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85676 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CPSF6 Protein |
| Description | Rabbit Polyclonal |
| Gene | CPSF6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6379_CPSF6-Antibody-Western-Blot-NBP1-85676-img0009.jpg)
Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6380_CPSF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85676-img0010.jpg)
Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles.
![Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human breast shows strong nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6381_CPSF6-Antibody-Immunohistochemistry-Paraffin-NBP1-85676-img0002.jpg)
Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human breast shows strong nuclear positivity in glandular cells.
![Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in human cell line HL-60.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6382_CPSF6-Antibody-Western-Blot-NBP1-85676-img0008.jpg)
Western Blot: CPSF6 Antibody [NBP1-85676] - Analysis in human cell line HL-60.
![Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/6383_CPSF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85676-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.