FXR1 Antibody

Name FXR1 Antibody
Supplier Novus Biologicals
Catalog NBP1-89546
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB Simple Western ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL
Purity/Format Immunogen affinity purified
Blocking Peptide FXR1 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene FXR1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.