WDR69 Antibody
| Name | WDR69 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92591 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | WDR69 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DAW1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: WDR69 Antibody [NBP1-92591] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2408_WDR69-Antibody-Western-Blot-NBP1-92591-img0003.jpg)
Western Blot: WDR69 Antibody [NBP1-92591] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: WDR69 Antibody [NBP1-92591] - Staining of human cell line A-431 shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2409_WDR69-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92591-img0004.jpg)
Immunocytochemistry/Immunofluorescence: WDR69 Antibody [NBP1-92591] - Staining of human cell line A-431 shows positivity in nucleus.
![Immunohistochemistry-Paraffin: WDR69 Antibody [NBP1-92591] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2410_WDR69-Antibody-Immunohistochemistry-Paraffin-NBP1-92591-img0002.jpg)
Immunohistochemistry-Paraffin: WDR69 Antibody [NBP1-92591] - Staining of human rectum shows moderate cytoplasmic and membranous positivity in glandular cells.
![Western Blot: WDR69 Antibody [NBP1-92591] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/2411_WDR69%2520Antibody-Western%2520Blot-NBP1-92591-img0005.jpg)
Western Blot: WDR69 Antibody [NBP1-92591] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4