LRRC59 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-93952
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: LRRC59 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: LRRC59
• Conjugate: Unconjugated

Product images

Western Blot: LRRC59 Antibody [NBP1-93952] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: LRRC59 Antibody [NBP1-93952] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: LRRC59 Antibody [NBP1-93952] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.

Western Blot: LRRC59 Antibody [NBP1-93952] - Analysis in human cell line CACO-2.