C2orf80 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-93544
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:GILMNSIPIEEVFKIYGADSSADSGTIKVPRVSSLRLSLHPFAMLTAPKAAAYARKQSVKSRKVTTNKNATSISAKEANATEWKSSQR
• Description: Rabbit Polyclonal
• Gene: C2orf80

Product images

Western Blot: C2orf80 Antibody [NBP1-93544] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Immunocytochemistry/Immunofluorescence: C2orf80 Antibody [NBP1-93544] - Staining of human cell line U-251 MG shows positivity in golgi apparatus.

Immunohistochemistry-Paraffin: C2orf80 Antibody [NBP1-93544] - Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Western Blot: C2orf80 Antibody [NBP1-93544] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue