WARS2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54653
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to WARS2(tryptophanyl tRNA synthetase 2, mitochondrial) The peptide sequence was selected from the middle region of WARS2. Peptide sequence TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: WARS2
• Conjugate: Unconjugated

Product images

Western Blot: WARS2 Antibody [NBP1-54653] - Sample Tissue: Human Fetal Muscle, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12

Western Blot: WARS2 Antibody [NBP1-54653] - Human Fetal Muscle. Lane A: Primary Antibody. Lane B: Primary Antibody and Blocking Peptide.

Western Blot: WARS2 Antibody [NBP1-54653] - Human Muscle lysate, concentration 0.2-1 ug/ml.