WDR6 Antibody
| Name | WDR6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54844 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6. Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WDR6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: WDR6 Antibody [NBP1-54844] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14292_WDR6-Antibody-Western-Blot-NBP1-54844-img0001.jpg)
Western Blot: WDR6 Antibody [NBP1-54844] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14293_WDR6-Antibody-Immunohistochemistry-NBP1-54844-img0004.jpg)
Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14294_WDR6-Antibody-Immunohistochemistry-NBP1-54844-img0003.jpg)
Immunohistochemistry: WDR6 Antibody [NBP1-54844] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X