SSX2IP Antibody
| Name | SSX2IP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59113 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SSX2IP(synovial sarcoma, X breakpoint 2 interacting protein) The peptide sequence was selected from the middle region of SSX2IP. Peptide sequence KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SSX2IP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SSX2IP Antibody [NBP1-59113] - 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14715_SSX2IP-Antibody-Western-Blot-NBP1-59113-img0001.jpg)
![Immunohistochemistry-Paraffin: SSX2IP Antibody [NBP1-59113] - Human kidney Tissue, antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14716_SSX2IP-Antibody-Immunohistochemistry-Paraffin-NBP1-59113-img0002.jpg)
![Immunohistochemistry: SSX2IP Antibody [NBP1-59113] - Staining of uman kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14717_SSX2IP%2520Antibody-Immunohistochemistry-NBP1-59113-img0003.jpg)