ZDHHC13 Antibody
| Name | ZDHHC13 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59026 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit |
| Antigen | Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | ZDHHC13 |
| Supplier Page | Shop |
![Western Blot: ZDHHC13 Antibody [NBP1-59026] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9515_ZDHHC13%2520Antibody-Western%2520Blot-NBP1-59026-img0001.jpg)
![Immunohistochemistry-Paraffin: ZDHHC13 Antibody [NBP1-59026] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9516_ZDHHC13%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59026-img0002.jpg)