Integrin beta 8 Antibody
| Name | Integrin beta 8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59269 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ITGB8(integrin, beta 8) The peptide sequence was selected from the C terminal of ITGB8. Peptide sequence CTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCAL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ITGB8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Reccomended Titration: 1 ug/mL Sample Type: Human Raji](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19853_Integrin%2520beta%25208%2520Antibody-Western%2520Blot-NBP1-59269-img0004.jpg)
Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Reccomended Titration: 1 ug/mL Sample Type: Human Raji
![Immunohistochemistry: Integrin beta 8 Antibody [NBP1-59269] - Human Kidney Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19854_Integrin-beta-8-Antibody-Immunohistochemistry-NBP1-59269-img0003.jpg)
Immunohistochemistry: Integrin beta 8 Antibody [NBP1-59269] - Human Kidney Antibody Dilution: 1.0 ug/ml.
![Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19855_Integrin-beta-8-Antibody-Western-Blot-NBP1-59269-img0002.jpg)
Western Blot: Integrin beta 8 Antibody [NBP1-59269] - Human Placenta lysate, concentration 0.2-1 ug/ml.