Name | Cadherin-8 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59221 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CDH8(cadherin 8, type 2) The peptide sequence was selected from the middle region of CDH8. Peptide sequence HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CDH8 |
Conjugate | Unconjugated |
Supplier Page | Shop |