Cadherin-8 Antibody
| Name | Cadherin-8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59221 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CDH8(cadherin 8, type 2) The peptide sequence was selected from the middle region of CDH8. Peptide sequence HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CDH8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Cadherin-8 Antibody [NBP1-59221] - Human Fetal Heart Lysate, concentration 1.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14341_Cadherin-8-Antibody-Western-Blot-NBP1-59221-img0001.jpg)
Western Blot: Cadherin-8 Antibody [NBP1-59221] - Human Fetal Heart Lysate, concentration 1.0ug/ml.
![Immunohistochemistry-Paraffin: Cadherin-8 Antibody [NBP1-59221] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14342_Cadherin-8-Antibody-Immunohistochemistry-Paraffin-NBP1-59221-img0003.jpg)
Immunohistochemistry-Paraffin: Cadherin-8 Antibody [NBP1-59221] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.