Connexin 36/GJD2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59254
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-F IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GJD2
• Conjugate: Unconjugated