HNRPH3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57163
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to HNRPH3 (heterogeneous nuclear ribonucleoprotein H3 (2H9)) The peptide sequence was selected from the N terminal of HNRPH3. Peptide sequence DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: HNRNPH3
• Conjugate: Unconjugated