NOL6 Antibody
| Name | NOL6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57231 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NOL6 (nucleolar protein family 6 (RNA-associated)) The peptide sequence was selected from the C terminal of NOL6. Peptide sequence VIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NOL6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NOL6 Antibody [NBP1-57231] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14538_NOL6-Antibody-Western-Blot-NBP1-57231-img0001.jpg)
Western Blot: NOL6 Antibody [NBP1-57231] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry: NOL6 Antibody [NBP1-57231] - Human Intestine Cellular data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14539_NOL6-Antibody-Immunohistochemistry-NBP1-57231-img0003.jpg)
Immunohistochemistry: NOL6 Antibody [NBP1-57231] - Human Intestine Cellular data: Epithelial cells of intestinal villas Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
![Immunohistochemistry-Paraffin: NOL6 Antibody [NBP1-57231] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14540_NOL6-Antibody-Immunohistochemistry-Paraffin-NBP1-57231-img0002.jpg)
Immunohistochemistry-Paraffin: NOL6 Antibody [NBP1-57231] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.