Name | ADAT1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57221 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Mouse, Rat, Pig, Dog, Horse |
Antigen | Synthetic peptides corresponding to ADAT1(adenosine deaminase, tRNA-specific 1) The peptide sequence was selected from the C terminal of ADAT1. Peptide sequence LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ADAT1 |
Supplier Page | Shop |