ADAT1 Antibody
| Name | ADAT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57221 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Dog, Horse |
| Antigen | Synthetic peptides corresponding to ADAT1(adenosine deaminase, tRNA-specific 1) The peptide sequence was selected from the C terminal of ADAT1. Peptide sequence LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADAT1 |
| Supplier Page | Shop |
![Western Blot: ADAT1 Antibody [NBP1-57221] - 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Thymus](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9573_ADAT1%2520Antibody-Western%2520Blot-NBP1-57221-img0001.jpg)
![Immunohistochemistry-Paraffin: ADAT1 Antibody [NBP1-57221] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9574_ADAT1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-57221-img0002.jpg)