POP4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57218
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to POP4 (processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae)) The peptide sequence was selected from the C terminal of POP4. Peptide sequence EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAK
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: POP4
• Conjugate: Unconjugated