Dnd1 Antibody
| Name | Dnd1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57258 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DND1(dead end homolog 1 (zebrafish)) The peptide sequence was selected from the C terminal of DND1. Peptide sequence HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DND1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dnd1 Antibody [NBP1-57258] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24218_Dnd1-Antibody-Western-Blot-NBP1-57258-img0002.jpg)
Western Blot: Dnd1 Antibody [NBP1-57258] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: Dnd1 Antibody [NBP1-57258] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in pinealocytes; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24219_Dnd1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57258-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Dnd1 Antibody [NBP1-57258] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in pinealocytes; Primary Antibody Concentration: 1:100