NOP56 Antibody
| Name | NOP56 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57358 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NOL5A(nucleolar protein 5A (56kDa with KKE/D repeat)) The peptide sequence was selected from the middle region of NOL5A. Peptide sequence YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | NOP56 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: NOP56 Antibody [NBP1-57358] - Antibody Titration: 1 ug/ml Positive control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24532_NOP56%2520Antibody-Western%2520Blot-NBP1-57358-img0004.jpg)
![Immunohistochemistry-Paraffin: NOP56 Antibody [NBP1-57358] - Human placenta tissue at an antibody concentration of 5.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24533_NOP56-Antibody-Immunohistochemistry-Paraffin-NBP1-57358-img0003.jpg)