MRM1 Antibody
| Name | MRM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57367 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MRM1 (mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of MRM1. Peptide sequence GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MRM1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MRM1 Antibody [NBP1-57367] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24742_MRM1-Antibody-Western-Blot-NBP1-57367-img0001.jpg)
![Immunohistochemistry-Paraffin: MRM1 Antibody [NBP1-57367] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24743_MRM1-Antibody-Immunohistochemistry-Paraffin-NBP1-57367-img0003.jpg)