Name | RPLP0 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57528 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPLP0(ribosomal protein, large, P0) The peptide sequence was selected from the middle region of RPLP0. Peptide sequence PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | RPLP0 |
Conjugate | Unconjugated |
Supplier Page | Shop |