RPL8 Antibody

Name RPL8 Antibody
Supplier Novus Biologicals
Catalog NBP1-57473
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to RPL8(ribosomal protein L8) The peptide sequence was selected from the C terminal of RPL8. Peptide sequence EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RPL8
Conjugate Unconjugated
Supplier Page Shop

Product images