Name | RPL8 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57473 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPL8(ribosomal protein L8) The peptide sequence was selected from the C terminal of RPL8. Peptide sequence EHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | RPL8 |
Conjugate | Unconjugated |
Supplier Page | Shop |