AUH Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57375
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to AUH (AU RNA binding protein/enoyl-Coenzyme A hydratase) The peptide sequence was selected from the C terminal of AUH. Peptide sequence IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: AUH
• Conjugate: Unconjugated