RPL8 Antibody
| Name | RPL8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57479 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RPL8(ribosomal protein L8) The peptide sequence was selected from the C terminal of RPL8. Peptide sequence KKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRVRGVAM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RPL8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RPL8 Antibody [NBP1-57479] - Titration: 0.3125ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24406_RPL8-Antibody-Western-Blot-NBP1-57479-img0003.jpg)
![Immunohistochemistry-Paraffin: RPL8 Antibody [NBP1-57479] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24407_RPL8-Antibody-Immunohistochemistry-Paraffin-NBP1-57479-img0002.jpg)