| Name | NIP7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57435 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NIP7 (nuclear import 7 homolog (S. cerevisiae)) The peptide sequence was selected from the C terminal of NIP7. Peptide sequence VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NIP7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |