SRP19 Antibody
| Name | SRP19 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57425 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to SRP19 (signal recognition particle 19kDa) The peptide sequence was selected from the middle region of SRP19. Peptide sequence LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | SRP19 |
| Supplier Page | Shop |
![Western Blot: SRP19 Antibody [NBP1-57425] - Titration: 1.25ug/ml, Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9634_SRP19%2520Antibody-Western%2520Blot-NBP1-57425-img0003.jpg)
![Immunohistochemistry-Paraffin: SRP19 Antibody [NBP1-57425] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/9635_SRP19%2520Antibody-Immunohistochemistry-Paraffin-NBP1-57425-img0002.jpg)