CPNE1 Antibody
| Name | CPNE1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57418 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CPNE1 (copine I) The peptide sequence was selected from the N terminal of CPNE1. Peptide sequence TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CPNE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CPNE1 Antibody [NBP1-57418] - HepG2 cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24408_CPNE1-Antibody-Western-Blot-NBP1-57418-img0001.jpg)
Western Blot: CPNE1 Antibody [NBP1-57418] - HepG2 cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: CPNE1 Antibody [NBP1-57418] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24409_CPNE1-Antibody-Immunohistochemistry-Paraffin-NBP1-57418-img0002.jpg)
Immunohistochemistry-Paraffin: CPNE1 Antibody [NBP1-57418] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.