EPB4IL2 Antibody
| Name | EPB4IL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56763 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EPB41L2(erythrocyte membrane protein band 4.1-like 2) The peptide sequence was selected from the middle region of EPB41L2. Peptide sequence AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EPB41L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: EPB4IL2 Antibody [NBP1-56763] - MCF-7 whole cell lysates, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24134_EPB4IL2-Antibody-Western-Blot-NBP1-56763-img0005.jpg)
![Immunohistochemistry-Paraffin: EPB4IL2 Antibody [NBP1-56763] - Human Prostate, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24135_EPB4IL2-Antibody-Immunohistochemistry-Paraffin-NBP1-56763-img0004.jpg)