Name | RPE Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56853 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB ICC/IF |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RPE(ribulose-5-phosphate-3-epimerase) The peptide sequence was selected from the middle region of RPE. Peptide sequence MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RPE |
Conjugate | Unconjugated |
Supplier Page | Shop |