PGRMC1 Antibody
| Name | PGRMC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59827 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PGRMC1(progesterone receptor membrane component 1) The peptide sequence was selected from the N terminal of PGRMC1. Peptide sequence MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PGRMC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PGRMC1 Antibody [NBP1-59827] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24688_PGRMC1-Antibody-Western-Blot-NBP1-59827-img0001.jpg)
Western Blot: PGRMC1 Antibody [NBP1-59827] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-59827] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24689_PGRMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-59827-img0002.jpg)
Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-59827] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.