FAM134B Antibody
| Name | FAM134B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59817 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to FAM134B The peptide sequence was selected from the middle region of FAM134B. Peptide sequence LSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FAM134B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: FAM134B Antibody [NBP1-59817] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19196_FAM134B-Antibody-Western-Blot-NBP1-59817-img0001.jpg)
![Immunohistochemistry-Paraffin: FAM134B Antibody [NBP1-59817] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19197_FAM134B-Antibody-Immunohistochemistry-Paraffin-NBP1-59817-img0002.jpg)