TMEM79 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59832
• Prices: $369.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC
• Species Reactivities: Human, Mouse, Dog, Horse, Rabbit
• Antigen: Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG.
• Purity/Format: Affinity purified
• Description: Rabbit Polyclonal
• Gene: TMEM79

Product images

Western Blot: TMEM79 Antibody [NBP1-59832] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product References

Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic - Tmem79/Matt is the matted mouse gene and is a predisposing gene for atopic

Saunders SP, Goh CS, Brown SJ, Palmer CN, Porter RM, Cole C, Campbell LE, Gierlinski M, Barton GJ, Schneider G, Balmain A, Prescott AR, Weidinger S, Baurecht H, Kabesch M, Gieger C, Lee YA, Tavendale R, Mukhopadhyay S, Turner SW, Madhok VB, Sullivan FM, Relton C, Burn J, Meggitt S, Smith CH, Allen MA, Barker JN, Reynolds NJ, Cordell HJ, Irvine AD, McLean WH, Sandilands A, Fallon PG. J Allergy Clin Immunol. 2013 Nov;132(5):1121-9.