SLC25A45 Antibody
| Name | SLC25A45 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59876 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LOC283130 The peptide sequence was selected from the C terminal of LOC283130. Peptide sequence GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC25A45 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC25A45 Antibody [NBP1-59876] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24917_SLC25A45-Antibody-Western-Blot-NBP1-59876-img0003.jpg)
Western Blot: SLC25A45 Antibody [NBP1-59876] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: SLC25A45 Antibody [NBP1-59876] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24918_SLC25A45-Antibody-Immunohistochemistry-Paraffin-NBP1-59876-img0002.jpg)
Immunohistochemistry-Paraffin: SLC25A45 Antibody [NBP1-59876] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.