PPP1R3A Antibody

Name PPP1R3A Antibody
Supplier Novus Biologicals
Catalog NBP1-59934
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to PPP1R3A(protein phosphatase 1, regulatory (inhibitor) subunit 3A) The peptide sequence was selected from the N terminal of PPP1R3A. Peptide sequence MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene PPP1R3A
Supplier Page Shop

Product images