Name | PPP1R3A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59934 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to PPP1R3A(protein phosphatase 1, regulatory (inhibitor) subunit 3A) The peptide sequence was selected from the N terminal of PPP1R3A. Peptide sequence MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSE. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | PPP1R3A |
Supplier Page | Shop |