RCE1 Antibody
| Name | RCE1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59922 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RCE1(RCE1 homolog, prenyl protein peptidase (S. cerevisiae)) The peptide sequence was selected from the N terminal of RCE1. Peptide sequence WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | RCE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RCE1 Antibody [NBP1-59922] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24863_RCE1-Antibody-Western-Blot-NBP1-59922-img0001.jpg)
![Immunohistochemistry-Paraffin: RCE1 Antibody [NBP1-59922] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24864_RCE1-Antibody-Immunohistochemistry-Paraffin-NBP1-59922-img0003.jpg)