KIAA0494 Antibody
| Name | KIAA0494 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59967 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIAA0494(KIAA0494) The peptide sequence was selected from the N terminal of KIAA0494. Peptide sequence DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | EFCAB14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: KIAA0494 Antibody [NBP1-59967] - HepG2 tissue lysate at a concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24239_KIAA0494-Antibody-Western-Blot-NBP1-59967-img0001.jpg)
![Immunohistochemistry-Paraffin: KIAA0494 Antibody [NBP1-59967] - Human Placenta Decidual cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24240_KIAA0494-Antibody-Immunohistochemistry-Paraffin-NBP1-59967-img0002.jpg)