CHIC2 Antibody
| Name | CHIC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59955 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CHIC2(cysteine-rich hydrophobic domain 2) The peptide sequence was selected from the N terminal of CHIC2. Peptide sequence EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CHIC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CHIC2 Antibody [NBP1-59955] - Titration: 0.25ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24248_CHIC2-Antibody-Western-Blot-NBP1-59955-img0001.jpg)
Western Blot: CHIC2 Antibody [NBP1-59955] - Titration: 0.25ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: CHIC2 Antibody [NBP1-59955] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24249_CHIC2-Antibody-Immunohistochemistry-Paraffin-NBP1-59955-img0002.jpg)
Immunohistochemistry-Paraffin: CHIC2 Antibody [NBP1-59955] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.