RER1 Antibody
| Name | RER1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59953 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RER1(RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of RER1. Peptide sequence GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEF |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RER1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RER1 Antibody [NBP1-59953] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24250_RER1-Antibody-Western-Blot-NBP1-59953-img0002.jpg)
Western Blot: RER1 Antibody [NBP1-59953] - 293T cells lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: RER1 Antibody [NBP1-59953] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24251_RER1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59953-img0003.jpg)
Immunocytochemistry/Immunofluorescence: RER1 Antibody [NBP1-59953] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution; Primary Antibody Concentration: 1:100