MOSPD3 Antibody

Name MOSPD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-60035
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to MOSPD3(motile sperm domain containing 3) The peptide sequence was selected from the C terminal of MOSPD3. Peptide sequence FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene MOSPD3
Conjugate Unconjugated
Supplier Page Shop

Product images