MOSPD3 Antibody
| Name | MOSPD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60035 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MOSPD3(motile sperm domain containing 3) The peptide sequence was selected from the C terminal of MOSPD3. Peptide sequence FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MOSPD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MOSPD3 Antibody [NBP1-60035] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24948_MOSPD3-Antibody-Western-Blot-NBP1-60035-img0001.jpg)
![Immunohistochemistry-Paraffin: MOSPD3 Antibody [NBP1-60035] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24949_MOSPD3-Antibody-Immunohistochemistry-Paraffin-NBP1-60035-img0003.jpg)