SLC38A3 Antibody
| Name | SLC38A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60103 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC38A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29916_SLC38A3-Antibody-Western-Blot-NBP1-60103-img0002.jpg)
Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green DAPI: Blue Gene Name : SLC38A3 Submitted by : Anonymous](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29917_SLC38A3-Antibody-Immunohistochemistry-NBP1-60103-img0005.jpg)
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green DAPI: Blue Gene Name : SLC38A3 Submitted by : Anonymous
![Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. submitted by anonymous customer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29918_SLC38A3-Antibody-Immunohistochemistry-NBP1-60103-img0004.jpg)
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. submitted by anonymous customer