SLC6A8 Antibody
| Name | SLC6A8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60082 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC6A8(solute carrier family 6 (neurotransmitter transporter, creatine), member 8) The peptide sequence was selected from the N terminal of SLC6A8. Peptide sequence CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTL |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC6A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC6A8 Antibody [NBP1-60082] - Sample Tissue: Human MDA-MB-435s, Human THP - 1 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19809_SLC6A8-Antibody-Western-Blot-NBP1-60082-img0004.jpg)
Western Blot: SLC6A8 Antibody [NBP1-60082] - Sample Tissue: Human MDA-MB-435s, Human THP - 1 Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: SLC6A8 Antibody [NBP1-60082] - Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19810_SLC6A8-Antibody-Immunohistochemistry-NBP1-60082-img0003.jpg)
Immunohistochemistry: SLC6A8 Antibody [NBP1-60082] - Paraffin Embedded Tissue: Human Muscle Cellular Data: Skeletal muscle cells Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X
![Western Blot: SLC6A8 Antibody [NBP1-60082] - MDA-MB-435S cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19811_SLC6A8-Antibody-Western-Blot-NBP1-60082-img0001.jpg)
Western Blot: SLC6A8 Antibody [NBP1-60082] - MDA-MB-435S cell lysate, Antibody Titration: 2.5ug/ml