SLC26A4 Antibody
| Name | SLC26A4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60106 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC26A4(solute carrier family 26, member 4) The peptide sequence was selected from the middle region of SLC26A4. Peptide sequence ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC26A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC26A4 Antibody [NBP1-60106] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25592_SLC26A4%2520Antibody-Western%2520Blot-NBP1-60106-img0004.jpg)
![Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-60106] - Human placenta tissue at an antibody concentration of 5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25593_SLC26A4%2520Antibody-Immunohistochemistry-Paraffin-NBP1-60106-img0005.jpg)