UQCR10 Antibody
| Name | UQCR10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62349 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UCRC(ubiquinol-cytochrome c reductase complex (7.2 kD)) The peptide sequence was selected from the middle region of UCRC. Peptide sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UQCR10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: UQCR10 Antibody [NBP1-62349] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14632_UQCR10-Antibody-Western-Blot-NBP1-62349-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: UQCR10 Antibody [NBP1-62349] - Antibody Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14633_UQCR10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-62349-img0003.jpg)