ACP2 Antibody
| Name | ACP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62491 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ACP2(acid phosphatase 2, lysosomal) The peptide sequence was selected from the middle region of ACP2 (NP_001601). Peptide sequence VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ACP2 Antibody [NBP1-62491] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24155_ACP2-Antibody-Western-Blot-NBP1-62491-img0001.jpg)
![Immunohistochemistry-Paraffin: ACP2 Antibody [NBP1-62491] - Human Liver tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24156_ACP2-Antibody-Immunohistochemistry-Paraffin-NBP1-62491-img0002.jpg)