CLPTM1L Antibody

Name CLPTM1L Antibody
Supplier Novus Biologicals
Catalog NBP1-62477
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLPTM1L(CLPTM1-like) The peptide sequence was selected from the middle region of CLPTM1L (NP_110409). Peptide sequence KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLPTM1L
Conjugate Unconjugated
Supplier Page Shop

Product images