ST3GAL5 Antibody
| Name | ST3GAL5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62444 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST3GAL5(ST3 beta-galactoside alpha-2,3-sialyltransferase 5) The peptide sequence was selected from the N terminal of ST3GAL5 (NP_003887). Peptide sequence DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ST3GAL5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST3GAL5 Antibody [NBP1-62444] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24178_ST3GAL5-Antibody-Western-Blot-NBP1-62444-img0004.jpg)
Western Blot: ST3GAL5 Antibody [NBP1-62444] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24179_ST3GAL5-Antibody-Immunohistochemistry-Paraffin-NBP1-62444-img0003.jpg)
Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.