PRPS2 Antibody
| Name | PRPS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57669 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PRPS2(phosphoribosyl pyrophosphate synthetase 2) The peptide sequence was selected from the middle region of PRPS2. Peptide sequence VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRPS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PRPS2 Antibody [NBP1-57669] - Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24436_PRPS2-Antibody-Western-Blot-NBP1-57669-img0003.jpg)
Western Blot: PRPS2 Antibody [NBP1-57669] - Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate.
![Immunohistochemistry-Paraffin: PRPS2 Antibody [NBP1-57669] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24437_PRPS2-Antibody-Immunohistochemistry-Paraffin-NBP1-57669-img0004.jpg)
Immunohistochemistry-Paraffin: PRPS2 Antibody [NBP1-57669] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.